General Information

  • ID:  hor005431
  • Uniprot ID:  P42633
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Anguilla rostrata (American eel) (Muraena rostrata)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Anguilla (genus), Anguillidae (family), Anguilliformes (order), Elopomorpha, Elopocephala, Elopocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ASTQHLCGSHLVEALYLVCGSNGFFFNPKD
  • Length:  30(1-30)
  • Propeptide:  ASTQHLCGSHLVEALYLVCGSNGFFFNPKDGIVEQCCHKPCSIFDLQNYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P42633-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005431_AF2.pdbhor005431_ESM.pdb

Physical Information

Mass: 377313 Formula: C146H216N38O43S2
Absent amino acids: IMRW Common amino acids: L
pI: 6.48 Basic residues: 3
Polar residues: 12 Hydrophobic residues: 11
Hydrophobicity: 18.67 Boman Index: -1643
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 118.33 Extinction Coefficient cystines: 1615
Absorbance 280nm: 55.69

Literature

  • PubMed ID:  1874385
  • Title:  The primary structure of glucagon-like peptide but not insulin has been conserved between the American eel, Anguilla rostrata and the European eel, Anguilla anguilla.